PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 200aa    MW: 22117.1 Da    PI: 9.8502
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015271genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.57e-182067249
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 rien+  r++tfskRr+gi KKA+ +  LC+aev v+ fs++g+ ++y
  Lus10015271 20 RIENSDARSITFSKRRAGIYKKASDIVSLCGAEVGVLFFSPSGRPFTY 67
                 9******************************************99888 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-231170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.2261171IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-221283IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-161333IPR002100Transcription factor, MADS-box
PfamPF003194.2E-212067IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-163348IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-164869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAEPENTKKT RGRRKIPMQR IENSDARSIT FSKRRAGIYK KASDIVSLCG AEVGVLFFSP  60
SGRPFTYGFP SIESVAGRFL RPVPETTDVQ GMVTDLAARR FNRMRNRLTI DELNLQVIEL  120
EAGSEAMKKR AEAVSTERRK KEEQAADWWD FPVEDLSLEQ MRIAESEMMN FSRYLERGSG  180
SGAAGRGLAG GNCSGAGVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-32AGAMOUS-like 61